PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010935230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 276aa    MW: 31630.9 Da    PI: 6.545
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010935230.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.84.6e-49211473128
             NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.. 95 
                     pGfrFhPt+eel+++yL++ v+gkkl++ ++i ++++y+++Pw+Lp  ++ +e+ewyfF++rd+k+++g r+nr+t++g+Wkatg+d+++ s   
  XP_010935230.1  21 PGFRFHPTEEELLDFYLRRAVQGKKLQI-DIIGTLNLYRHDPWELPGLARIGEREWYFFVPRDRKQSNGGRPNRTTEHGFWKATGSDRPIRSVad 114
                     9***************************.99***************8778899*************************************99876 PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++l+glkktLv+y+grap+g+ktdWvm+eyrl
  XP_010935230.1 115 PKRLIGLKKTLVYYEGRAPRGSKTDWVMNEYRL 147
                     7788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-5719166IPR003441NAC domain
PROSITE profilePS5100555.51619166IPR003441NAC domain
PfamPF023653.0E-2521147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MSTEGRESNS MEQSGAGLEL PGFRFHPTEE ELLDFYLRRA VQGKKLQIDI IGTLNLYRHD  60
PWELPGLARI GEREWYFFVP RDRKQSNGGR PNRTTEHGFW KATGSDRPIR SVADPKRLIG  120
LKKTLVYYEG RAPRGSKTDW VMNEYRLPDP TTPPTADIVL CKIYRKATSL KELEQRAAMA  180
SPNSKLIVDS VLSSDQESLQ KWMVVDDDGG VKEAKEEVGK ETEVEIFAES ARSINLPKLE  240
VPKYNGLEWM QDPFLTQLRS PWMDPWSPYH ASVLNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-502116617168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010935230.10.0PREDICTED: protein FEZ-like
SwissprotQ9FIW57e-57NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLM0TEJ31e-125M0TEJ3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P04030_0011e-124(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP177038105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.16e-92NAC domain containing protein 36